Proteintech, 19869-1-AP, GTF2H3 Polyclonal antibody

Size: 20ul / 150ul The GTF2H3 (19869-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2H3 in WB, ELISA applications with reactivity to human samples 19869-1-AP targets GTF2H3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7131 Product name: Recombinant human GTF2H3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-210 aa of BC065250 Sequence: KQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT Predict reactive species Full Name: general transcription factor IIH, polypeptide 3, 34kDa Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC065250 Gene Symbol: GTF2H3 Gene ID (NCBI): 2967 RRID: AB_2878617 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13889 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.