Iright
BRAND / VENDOR: Proteintech

Proteintech, 19891-1-AP, TRUB2 Polyclonal antibody

CATALOG NUMBER: 19891-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRUB2 (19891-1-AP) by Proteintech is a Polyclonal antibody targeting TRUB2 in WB, IHC, ELISA applications with reactivity to human samples 19891-1-AP targets TRUB2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, HepG2 cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13726 Product name: Recombinant human TRUB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC001457 Sequence: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ Predict reactive species Full Name: TruB pseudouridine (psi) synthase homolog 2 (E. coli) Calculated Molecular Weight: 331 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001457 Gene Symbol: TRUB2 Gene ID (NCBI): 26995 RRID: AB_10640900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95900 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924