Iright
BRAND / VENDOR: Proteintech

Proteintech, 19905-1-AP, GTL3 Polyclonal antibody

CATALOG NUMBER: 19905-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GTL3 (19905-1-AP) by Proteintech is a Polyclonal antibody targeting GTL3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 19905-1-AP targets GTL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GTL3 (Cilia- and flagella-associated protein 20, also named CFAP20 ) may play a role in axonemal structure organization and motility. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13881 Product name: Recombinant human GTL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC005152 Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ Predict reactive species Full Name: chromosome 16 open reading frame 80 Calculated Molecular Weight: 193 aa, 23 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC005152 Gene Symbol: GTL3 Gene ID (NCBI): 29105 RRID: AB_3669317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6A4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924