Proteintech, 19907-1-AP, NUPL1 Polyclonal antibody

Size: 20ul / 150ul The NUPL1 (19907-1-AP) by Proteintech is a Polyclonal antibody targeting NUPL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 19907-1-AP targets NUPL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, L02 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13901 Product name: Recombinant human NUPL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-599 aa of BC001104 Sequence: VICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR Predict reactive species Full Name: nucleoporin like 1 Calculated Molecular Weight: 599 aa, 61 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC001104 Gene Symbol: NUPL1 Gene ID (NCBI): 9818 RRID: AB_10694673 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.