Iright
BRAND / VENDOR: Proteintech

Proteintech, 19912-1-AP, PPDPF Polyclonal antibody

CATALOG NUMBER: 19912-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPDPF (19912-1-AP) by Proteintech is a Polyclonal antibody targeting PPDPF in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 19912-1-AP targets PPDPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse pancreas tissue Positive IHC detected in: human colon cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Pancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13740 Product name: Recombinant human C20orf149 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC002531 Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS Predict reactive species Full Name: chromosome 20 open reading frame 149 Calculated Molecular Weight: 114 aa, 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC002531 Gene Symbol: PPDPF Gene ID (NCBI): 79144 RRID: AB_10642438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3Y8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924