Iright
BRAND / VENDOR: Proteintech

Proteintech, 20123-1-AP, CUEDC2 Polyclonal antibody

CATALOG NUMBER: 20123-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CUEDC2 (20123-1-AP) by Proteintech is a Polyclonal antibody targeting CUEDC2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 20123-1-AP targets CUEDC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse kidney tissue, HeLa cells, human brain tissue, human kidney tissue, Jurkat cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CUE domain-containing 2 (CUEDC2) is a ubiquitin-binding motif-containing protein involved in the regulation of the cell cycle, inflammation, and tumorigenesis. It is ubiquitously expressed in human tissues and organs, not only highly expressed in the normal brain, heart and testis, but also some kinds of cancers, such as breast, ovarian and kidney cancers. CUEDC2 could act as an adaptor protein to target IκB kinase (IKK) for dephosphorylation and inactivation by recruiting protein phosphatase (PP1), and thus repressed activation of the transcription factor NF-κB. Moreover, CUEDC2, is a key factor in endocrine resistance in breast cancer. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13847 Product name: Recombinant human CUEDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC000262 Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA Predict reactive species Full Name: CUE domain containing 2 Calculated Molecular Weight: 287 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000262 Gene Symbol: CUEDC2 Gene ID (NCBI): 79004 RRID: AB_10638318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H467 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924