Iright
BRAND / VENDOR: Proteintech

Proteintech, 20124-1-AP, PP4R4 Polyclonal antibody

CATALOG NUMBER: 20124-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PP4R4 (20124-1-AP) by Proteintech is a Polyclonal antibody targeting PP4R4 in WB, ELISA applications with reactivity to human, mouse, rat samples 20124-1-AP targets PP4R4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PP4R4 (also known as SMEK1) is a regulatory subunit of protein phosphatase 4 (PP4), a serine/threonine phosphatase complex crucial for diverse cellular processes. It plays a key role in directing PP4's activity and substrate specificity, particularly in the DNA damage response, cell cycle progression, and centrosome maturation. Studies highlight its involvement in critical pathways such as ATM/ATR signaling for DNA repair and its regulatory function in cell division. Dysregulation of PP4R4 is implicated in genomic instability and is associated with various diseases, including cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13868 Product name: Recombinant human PPP4R4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002650 Sequence: MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR Predict reactive species Full Name: protein phosphatase 4, regulatory subunit 4 Calculated Molecular Weight: 417 aa, 47 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC002650 Gene Symbol: PP4R4 Gene ID (NCBI): 57718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924