Iright
BRAND / VENDOR: Proteintech

Proteintech, 20156-1-AP, RDM1 Polyclonal antibody

CATALOG NUMBER: 20156-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RDM1 (20156-1-AP) by Proteintech is a Polyclonal antibody targeting RDM1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20156-1-AP targets RDM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, human placenta tissue, MCF-7 cells Positive IHC detected in: human lung tissue, human brain tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14077 Product name: Recombinant human RDM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC038301 Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD Predict reactive species Full Name: RAD52 motif 1 Calculated Molecular Weight: 284 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC038301 Gene Symbol: RDM1 Gene ID (NCBI): 201299 RRID: AB_10666433 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NG50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924