Proteintech, 20162-1-AP, KLHL29 Polyclonal antibody

Size: 20ul / 150ul The KLHL29 (20162-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL29 in IHC, ELISA applications with reactivity to human samples 20162-1-AP targets KLHL29 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse kidney tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14087 Product name: Recombinant human KLHL29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-503 aa of BC015667 Sequence: YFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER Predict reactive species Full Name: kelch-like 29 (Drosophila) Calculated Molecular Weight: 875 aa, 94 kDa GenBank Accession Number: BC015667 Gene Symbol: KLHL29 Gene ID (NCBI): 114818 RRID: AB_10664931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.