Iright
BRAND / VENDOR: Proteintech

Proteintech, 20163-1-AP, BUD13 Polyclonal antibody

CATALOG NUMBER: 20163-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BUD13 (20163-1-AP) by Proteintech is a Polyclonal antibody targeting BUD13 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20163-1-AP targets BUD13 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BUD13 homolog (BUD13) is a component of the retention and splicing (RES) complex, previously identified in yeast as a splicing factor affecting nuclear pre-mRNA retention. As an RNA binding protein (RBP), BUD13 expression is associated with poor prognosis and may be involved in the development and progression of hepatocellular carcinoma (PMID: 37605593). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13665 Product name: Recombinant human BUD13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-619 aa of BC006350 Sequence: DTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM Predict reactive species Full Name: BUD13 homolog (S. cerevisiae) Calculated Molecular Weight: 619 aa, 71 kDa Observed Molecular Weight: 71-85 kDa GenBank Accession Number: BC006350 Gene Symbol: BUD13 Gene ID (NCBI): 84811 RRID: AB_2878650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924