Proteintech, 20181-1-AP, ERp19 Polyclonal antibody

Size: 20ul / 150ul The ERp19 (20181-1-AP) by Proteintech is a Polyclonal antibody targeting ERp19 in WB, IHC, ELISA applications with reactivity to human samples 20181-1-AP targets ERp19 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A172 cells, LN-229 cells, U-251 cells Positive IHC detected in: human liver cancer tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TXNDC12, which is known as thioredoxin domain-containing protein 12, ERp16, ERp18, ERp19, or hTLP19, is a member of the protein disulfide isomerase (PDI) family that plays important roles in cancer development and progression. TXNDC12 has been demonstrated to contribute to tumorigenicity in human gastric cancer by promoting cell growth, migration, and invasion(PMID: 25940440). Other studies also revealed the overexpression of TXNDC12 promotes HCC metastasis through β-catenin-mediated induction of EMT and that TXNDC12 has the potential to be a prognostic factor and therapeutic target of HCC. (PMID: 31570854) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14045 Product name: Recombinant human TXNDC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC001493 Sequence: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL Predict reactive species Full Name: thioredoxin domain containing 12 (endoplasmic reticulum) Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 20 kDa, 40 kDa GenBank Accession Number: BC001493 Gene Symbol: TXNDC12 Gene ID (NCBI): 51060 RRID: AB_10646468 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95881 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.