Iright
BRAND / VENDOR: Proteintech

Proteintech, 20194-1-AP, MRTO4 Polyclonal antibody

CATALOG NUMBER: 20194-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRTO4 (20194-1-AP) by Proteintech is a Polyclonal antibody targeting MRTO4 in WB, ELISA applications with reactivity to human, mouse, rat samples 20194-1-AP targets MRTO4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, mouse heart tissue, mouse brain tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14122 Product name: Recombinant human MRTO4 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-239 aa of BC003013 Sequence: MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD Predict reactive species Full Name: mRNA turnover 4 homolog (S. cerevisiae) Calculated Molecular Weight: 239 aa, 28 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC003013 Gene Symbol: MRTO4 Gene ID (NCBI): 51154 RRID: AB_10697684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924