Iright
BRAND / VENDOR: Proteintech

Proteintech, 20199-1-AP, STEAP1 Polyclonal antibody

CATALOG NUMBER: 20199-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STEAP1 (20199-1-AP) by Proteintech is a Polyclonal antibody targeting STEAP1 in WB, IHC, IP, ELISA applications with reactivity to human samples 20199-1-AP targets STEAP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, DU 145 cells Positive IP detected in: LNCaP cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14134 Product name: Recombinant human STEAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC011802 Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI Predict reactive species Full Name: six transmembrane epithelial antigen of the prostate 1 Calculated Molecular Weight: 339 aa, 40 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC011802 Gene Symbol: STEAP1 Gene ID (NCBI): 26872 RRID: AB_11182488 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924