Iright
BRAND / VENDOR: Proteintech

Proteintech, 20284-1-AP, RADIL Polyclonal antibody

CATALOG NUMBER: 20284-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RADIL (20284-1-AP) by Proteintech is a Polyclonal antibody targeting RADIL in WB, IP, ELISA applications with reactivity to human, mouse samples 20284-1-AP targets RADIL in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, SH-SY5Y cells, mouse testis tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Radil is a broadly expressed adapter protein that contains a RA-like domain, a PDZ domain and a DIL domain. Like RAPL and RIAM, Radil interacts preferentially with active GTP-bound Rap1, and overexpression of Radil enhances integrin-mediated adhesion. In addition, Radil knockdown inhibits cell-substrate adhesion in HT1080, AD293, and NMuMG cells and results in migration defects in SW1353 and zebrafish neural crest cells (PMID: 17704304). Radil regulates neutrophil adhesion by specifically enhancing β2-integrin activation, as well as focal adhesion kinase (FAK) and paxillin phosphorylation (PMID: 23097489). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13996 Product name: Recombinant human RADIL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 776-1075 aa of BC004919 Sequence: IVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGPSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL Predict reactive species Full Name: Ras association and DIL domains Calculated Molecular Weight: 1075 aa, 117 kDa Observed Molecular Weight: 117 kDa GenBank Accession Number: BC004919 Gene Symbol: RADIL Gene ID (NCBI): 55698 RRID: AB_10732684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924