Proteintech, 20303-1-AP, ANKH Polyclonal antibody

Size: 20ul / 150ul The ANKH (20303-1-AP) by Proteintech is a Polyclonal antibody targeting ANKH in WB, ELISA applications with reactivity to human samples 20303-1-AP targets ANKH in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14125 Product name: Recombinant human ANKH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-337 aa of BC014526 Sequence: GALVRCTTLCLGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVTAAHIKKFTFVCMALSLT Predict reactive species Full Name: ankylosis, progressive homolog (mouse) Calculated Molecular Weight: 492 aa, 54 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC014526 Gene Symbol: ANKH Gene ID (NCBI): 56172 RRID: AB_2878666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.