Proteintech, 20307-1-AP, GPR171 Polyclonal antibody

Size: 20ul / 150ul The GPR171 (20307-1-AP) by Proteintech is a Polyclonal antibody targeting GPR171 in IHC, ELISA applications with reactivity to human samples 20307-1-AP targets GPR171 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14141 Product name: Recombinant human GPR171 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-319 aa of BC036815 Sequence: YHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPVLYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA Predict reactive species Full Name: G protein-coupled receptor 171 Calculated Molecular Weight: 319 aa, 37 kDa GenBank Accession Number: BC036815 Gene Symbol: GPR171 Gene ID (NCBI): 29909 RRID: AB_2878669 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14626 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.