Iright
BRAND / VENDOR: Proteintech

Proteintech, 20308-1-AP, ELOVL2 Polyclonal antibody

CATALOG NUMBER: 20308-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELOVL2 (20308-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL2 in IHC, ELISA applications with reactivity to human, mouse, rat samples 20308-1-AP targets ELOVL2 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human testis tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14143 Product name: Recombinant human ELOVL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-185 aa of BC050278 Sequence: LLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYS Predict reactive species Full Name: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 Calculated Molecular Weight: 296 aa, 35 kDa GenBank Accession Number: BC050278 Gene Symbol: ELOVL2 Gene ID (NCBI): 54898 RRID: AB_10666201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXB9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924