Proteintech, 20310-1-AP, DRD5 Polyclonal antibody

Size: 20ul / 150ul The DRD5 (20310-1-AP) by Proteintech is a Polyclonal antibody targeting DRD5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 20310-1-AP targets DRD5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information DRD5, is a G-protein coupled receptor and involved in diversified physiological and pathological processes. this receptor stimulates adenylyl cyclase activity and is expressed in the limbic area of the mammalian brain(PMID:14699430). Studies have shown that DRD5 is highly expressed in colonic macrophages and DRD5 deficiency exacerbates DSS(dextran sodium sulfate)-induced colitis(PMID:34001860). in addition, DRD5 agonists were potent inhibitors of pituitary tumor growth(PMID:28613975). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14145 Product name: Recombinant human DRD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-477 aa of BC009748 Sequence: NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH Predict reactive species Full Name: dopamine receptor D5 Calculated Molecular Weight: 477 aa, 53 kDa Observed Molecular Weight: 50-53 kDa GenBank Accession Number: BC009748 Gene Symbol: DRD5 Gene ID (NCBI): 1816 RRID: AB_10699880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.