Iright
BRAND / VENDOR: Proteintech

Proteintech, 20312-1-AP, NDUFA9 Polyclonal antibody

CATALOG NUMBER: 20312-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFA9 (20312-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20312-1-AP targets NDUFA9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFA9(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14150 Product name: Recombinant human NDUFA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC009311 Sequence: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLL Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa Calculated Molecular Weight: 377 aa, 43 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC009311 Gene Symbol: NDUFA9 Gene ID (NCBI): 4704 RRID: AB_10694678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16795 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924