Product Description
Size: 20ul / 150ul
The CLN6 (20315-1-AP) by Proteintech is a Polyclonal antibody targeting CLN6 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
20315-1-AP targets CLN6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, HEK-293 cells
Positive IP detected in: HEK-293 cells
Positive IHC detected in: human colon tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14159 Product name: Recombinant human CLN6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-190 aa of BC010849 Sequence: IMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILF Predict reactive species
Full Name: ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Calculated Molecular Weight: 311 aa, 36 kDa
Observed Molecular Weight: 30 kDa
GenBank Accession Number: BC010849
Gene Symbol: CLN6
Gene ID (NCBI): 54982
RRID: AB_2878671
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NWW5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924