Iright
BRAND / VENDOR: Proteintech

Proteintech, 20324-1-AP, ISCA1 Polyclonal antibody

CATALOG NUMBER: 20324-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ISCA1 (20324-1-AP) by Proteintech is a Polyclonal antibody targeting ISCA1 in WB, ELISA applications with reactivity to human, mouse samples 20324-1-AP targets ISCA1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse cerebellum tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ISCA1, also named as HBLD2 and hIscA, belongs to the hesB/iscA family. It is involved in the assembly of mitochondrial iron-sulfur proteins. ISCA1 probably involved in the binding of an intermediate of Fe/S cluster assembly. ISCA1 plays an important role in both mitochondrial and cytosolic iron-sulfur cluster biogenesis, and a notable component of the latter is the interaction between ISCA1 and IOP1. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14188 Product name: Recombinant human ISCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC002675 Sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI Predict reactive species Full Name: iron-sulfur cluster assembly 1 homolog (S. cerevisiae) Calculated Molecular Weight: 129 aa, 14 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC002675 Gene Symbol: ISCA1 Gene ID (NCBI): 81689 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUE6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924