Proteintech, 20328-1-AP, TIAF1 Polyclonal antibody

Size: 20ul / 150ul The TIAF1 (20328-1-AP) by Proteintech is a Polyclonal antibody targeting TIAF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20328-1-AP targets TIAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14023 Product name: Recombinant human TIAF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC131561 Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG Predict reactive species Full Name: TGFB1-induced anti-apoptotic factor 1 Calculated Molecular Weight: 115 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC131561 Gene Symbol: TIAF1 Gene ID (NCBI): 9220 RRID: AB_10858233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95411 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.