Iright
BRAND / VENDOR: Proteintech

Proteintech, 20330-1-AP, B4GALT2 Polyclonal antibody

CATALOG NUMBER: 20330-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The B4GALT2 (20330-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20330-1-AP targets B4GALT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue, mouse large intestine tissue, mouse ovary tissue, mouse skeletal muscle tissue Positive IHC detected in: human colon cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14046 Product name: Recombinant human B4GALT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-176 aa of BC002431 Sequence: PGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMD Predict reactive species Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 Calculated Molecular Weight: 372 aa, 42 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC002431 Gene Symbol: B4GALT2 Gene ID (NCBI): 8704 RRID: AB_10693615 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60909 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924