Iright
BRAND / VENDOR: Proteintech

Proteintech, 20334-1-AP, AQP5 Polyclonal antibody

CATALOG NUMBER: 20334-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AQP5 (20334-1-AP) by Proteintech is a Polyclonal antibody targeting AQP5 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 20334-1-AP targets AQP5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: mouse lung tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information AQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14103 Product name: Recombinant human AQP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species Full Name: aquaporin 5 Calculated Molecular Weight: 265 aa, 28 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC032946 Gene Symbol: AQP5 Gene ID (NCBI): 362 RRID: AB_2918066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55064 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924