Proteintech, 20347-1-AP, FGD3 Polyclonal antibody

Size: 20ul / 150ul The FGD3 (20347-1-AP) by Proteintech is a Polyclonal antibody targeting FGD3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20347-1-AP targets FGD3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, K-562 cells, HEK-293T cells, HeLa cells, A549 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14155 Product name: Recombinant human FGD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 570-725 aa of BC032429 Sequence: KAENSRQSRVCRDCFLTQPVAPESTEKTPTADPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPMGAAAP Predict reactive species Full Name: FYVE, RhoGEF and PH domain containing 3 Calculated Molecular Weight: 725 aa, 79 kDa Observed Molecular Weight: 79 kDa GenBank Accession Number: BC032429 Gene Symbol: FGD3 Gene ID (NCBI): 89846 RRID: AB_10693616 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JSP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.