Product Description
Size: 20ul / 150ul
The TMEM176A (20378-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM176A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
20378-1-AP targets TMEM176A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: fetal human brain tissue
Positive IHC detected in: mouse brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14194 Product name: Recombinant human TMEM176A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-203 aa of BC008303 Sequence: LAAFSTAIAALKLWNEDFRYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLL Predict reactive species
Full Name: transmembrane protein 176A
Calculated Molecular Weight: 235 aa, 26 kDa
Observed Molecular Weight: 28 kDa
GenBank Accession Number: BC008303
Gene Symbol: TMEM176A
Gene ID (NCBI): 55365
RRID: AB_10697661
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96HP8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924