Iright
BRAND / VENDOR: Proteintech

Proteintech, 20384-1-AP, NPHS2 Polyclonal antibody

CATALOG NUMBER: 20384-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPHS2 (20384-1-AP) by Proteintech is a Polyclonal antibody targeting NPHS2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 20384-1-AP targets NPHS2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat kidney tissue Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat kidney tissue, mouse kidney tissue Positive IF-Fro detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information NPHS2 (also known as Podocin) is a membrane protein located on the podocyte foot process and is the critical component of the glomerular filtration barrier. Mutations of NPHS2 cause recessive steroidresistant nephrotic syndrome. Two isoforms of NPHS2 exist with molecular weights of 42 kDa and 35 kDa, respectively. (PMID: 21499232) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14213 Product name: Recombinant human NPHS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-315 aa of BC029141 Sequence: CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML Predict reactive species Full Name: nephrosis 2, idiopathic, steroid-resistant (podocin) Calculated Molecular Weight: 383 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC029141 Gene Symbol: NPHS2 Gene ID (NCBI): 7827 RRID: AB_10697662 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924