Proteintech, 20385-1-AP, ZNF146 Polyclonal antibody

Size: 20ul / 150ul The ZNF146 (20385-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF146 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20385-1-AP targets ZNF146 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse lung tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14223 Product name: Recombinant human ZNF146 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-292 aa of BC005154 Sequence: FECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH Predict reactive species Full Name: zinc finger protein 146 Calculated Molecular Weight: 292 aa, 33 kDa Observed Molecular Weight: 20-25 kDa, 33-35 kDa GenBank Accession Number: BC005154 Gene Symbol: ZNF146 Gene ID (NCBI): 7705 RRID: AB_10694154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15072 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.