Iright
BRAND / VENDOR: Proteintech

Proteintech, 20407-1-AP, SNRPE Polyclonal antibody

CATALOG NUMBER: 20407-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNRPE (20407-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPE in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20407-1-AP targets SNRPE in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse placenta tissue, human placenta tissue, human brain tissue Positive IHC detected in: mouse brain tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The snRNP E (SNRPE)protein is one of several proteins associated with the U family of small nuclear RNAs that are involved in RNA processing. It functions in the U7 snRNP complex that is involved in histone 3'-end processing and also associated with snRNP U1, U2, U4/U6 and U5. This antibody raises against the full length of human SNRPE, and can recognize two bands of SNRPE, include a 9 kDa band(isoform) and a 11kDa band(SNRPE) (PMID:23246290) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14227 Product name: Recombinant human SNRPE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC002639 Sequence: MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide E Calculated Molecular Weight: 92 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC002639 Gene Symbol: SNRPE Gene ID (NCBI): 6635 RRID: AB_10699882 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62304 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924