Proteintech, 20409-1-AP, APC15 Polyclonal antibody

Size: 20ul / 150ul The APC15 (20409-1-AP) by Proteintech is a Polyclonal antibody targeting APC15 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20409-1-AP targets APC15 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, HEK-293 cells Positive IHC detected in: human placenta tissue, human lung tissue, human pancreas tissue, mouse adrenal gland tissue, mouse lung tissue, mouse spleen tissue, rat adrenal gland tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14237 Product name: Recombinant human C11orf51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC005156 Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI Predict reactive species Full Name: chromosome 11 open reading frame 51 Calculated Molecular Weight: 121 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005156 Gene Symbol: APC15 Gene ID (NCBI): 25906 RRID: AB_10694279 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60006 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.