Proteintech, 20427-1-AP, CCDC56/COA3 Polyclonal antibody

Size: 20ul / 150ul The CCDC56/COA3 (20427-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC56/COA3 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20427-1-AP targets CCDC56/COA3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human COX assembly factor 3 (COA3), also known as CCDC56 (coiled-coil domain-containing protein 56), is a mitochondrial transmembrane protein responsible for cytochrome c oxidase (COX) protein complex assembly. CCDC56/COA3 is located on chromosome 17 (17q.21.31) and encodes an 11.7-kDa protein with predicted transmembrane and coiled-coil domains (PMID: 22610097). CCDC56/COA3 is overexpressed at both mRNA and protein levels in human NSCLC cells, mainly as a result of decreased miR-338-3p level (PMID: 36119836). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14260 Product name: Recombinant human CCDC56 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC002698 Sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS Predict reactive species Full Name: coiled-coil domain containing 56 Calculated Molecular Weight: 106 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC002698 Gene Symbol: CCDC56 Gene ID (NCBI): 28958 RRID: AB_10695182 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2R0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.