Iright
BRAND / VENDOR: Proteintech

Proteintech, 20433-1-AP, INSR/CD220 Polyclonal antibody

CATALOG NUMBER: 20433-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INSR/CD220 (20433-1-AP) by Proteintech is a Polyclonal antibody targeting INSR/CD220 in WB, IP, ELISA applications with reactivity to human samples 20433-1-AP targets INSR/CD220 in WB, IHC, IF, IP, CoIP, Dot blot, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, HT-1080 cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The biological effects of INS are mediated by a membrane-spanning cell surface receptor that has been shown to consist of disulfide-linked alpha-subunits (135 kDa) and beta-subunits (95 kDa) that are cleaved products of a common precursor. The binding of INS to the receptor extracellular domain results in intracellular activation of a tyrosine-specific kinase activity and the generation of signals that determine the cellular response (PMID: 2369896). This antibody raised against 980-1382aa of human INS receptor can recognize full-length INS receptor precursor and INS receptor beta subunit. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, zebrafish, bovine, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13922 Product name: Recombinant human INSR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 968-1370 aa of BC117172 Sequence: RKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS Predict reactive species Full Name: INSR Calculated Molecular Weight: 1382 aa, 156 kDa Observed Molecular Weight: 190 kDa, 135 kDa, 95 kDa GenBank Accession Number: BC117172 Gene Symbol: INSR Gene ID (NCBI): 3643 RRID: AB_10646469 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06213 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924