Iright
BRAND / VENDOR: Proteintech

Proteintech, 20440-1-AP, COPZ1 Polyclonal antibody

CATALOG NUMBER: 20440-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COPZ1 (20440-1-AP) by Proteintech is a Polyclonal antibody targeting COPZ1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 20440-1-AP targets COPZ1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: COS-7 cells, K-562 cells, Jurkat cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14234 Product name: Recombinant human COPZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-84 aa of BC002849 Sequence: YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSY Predict reactive species Full Name: coatomer protein complex, subunit zeta 1 Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC002849 Gene Symbol: COPZ1 Gene ID (NCBI): 22818 RRID: AB_10733095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924