Iright
BRAND / VENDOR: Proteintech

Proteintech, 20444-1-AP, C5orf44 Polyclonal antibody

CATALOG NUMBER: 20444-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C5orf44 (20444-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf44 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20444-1-AP targets C5orf44 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human kidney tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The function of C5orf44 has not been widely studied, and is yet to be fully elucidated. The MW of this protein is 47 kDa, and this antibody specially recognises the 47 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14267 Product name: Recombinant human C5orf44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC012006 Sequence: MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQN Predict reactive species Full Name: chromosome 5 open reading frame 44 Calculated Molecular Weight: 417 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC012006 Gene Symbol: C5orf44 Gene ID (NCBI): 80006 RRID: AB_10697663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A5PLN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924