Proteintech, 20463-1-AP, TSPAN2 Polyclonal antibody

Size: 20ul / 150ul The TSPAN2 (20463-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 20463-1-AP targets TSPAN2 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells Positive IP detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TSPAN2 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. It has been reported that TSPAN2 is involved in cell invasion and motility during lung cancer progression (PMID: 24726368). TSPAN2 enhances cell motility and invasiveness by assisting CD44 in scavenging intracellular reactive oxygen species. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14299 Product name: Recombinant human TSPAN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-199 aa of BC021675 Sequence: AEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGL Predict reactive species Full Name: tetraspanin 2 Calculated Molecular Weight: 221 aa, 24 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC021675 Gene Symbol: TSPAN2 Gene ID (NCBI): 10100 RRID: AB_2878691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60636 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.