Iright
BRAND / VENDOR: Proteintech

Proteintech, 20479-1-AP, TMEM204 Polyclonal antibody

CATALOG NUMBER: 20479-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM204 (20479-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM204 in WB, IHC, IP, ELISA applications with reactivity to human samples 20479-1-AP targets TMEM204 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse lung tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14353 Product name: Recombinant human TMEM204 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-114 aa of BC004932 Sequence: VSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPSPGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQ Predict reactive species Full Name: transmembrane protein 204 Calculated Molecular Weight: 226 aa, 25 kDa Observed Molecular Weight: 24-30 kDa GenBank Accession Number: BC004932 Gene Symbol: TMEM204 Gene ID (NCBI): 79652 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924