Iright
BRAND / VENDOR: Proteintech

Proteintech, 20483-1-AP, WDR32 Polyclonal antibody

CATALOG NUMBER: 20483-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR32 (20483-1-AP) by Proteintech is a Polyclonal antibody targeting WDR32 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20483-1-AP targets WDR32 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information WDR32, containing seven WD repeats, is also termed DDB1- and CUL4-associated factor 10 (DCAF10), which may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex (PMID: 16949367). WDR32 is able to interact with DDB1 (PMID: 16949367). WDR32 is supposed to be implicated in process of ubiquitin-dependent protein degradation system. Two isoforms are described and produced by alternative splicing. Proteintech's WDR32 antibody 20483-1-AP majorly detects WDR32 isoform1 with a theoretical MW of 61 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14360 Product name: Recombinant human WDR32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC003520 Sequence: TRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTNSLEVGSYPILRARRTTSSSGVSPRNSLEVVTPEVLGESDHGNCITSLQLHPKGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLRLTHYIEEANVGRGYIKELCFSPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF Predict reactive species Full Name: WD repeat domain 32 Calculated Molecular Weight: 559 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC003520 Gene Symbol: WDR32 Gene ID (NCBI): 79269 RRID: AB_10695183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5QP82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924