Iright
BRAND / VENDOR: Proteintech

Proteintech, 20520-1-AP, FAM164C Polyclonal antibody

CATALOG NUMBER: 20520-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM164C (20520-1-AP) by Proteintech is a Polyclonal antibody targeting FAM164C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 20520-1-AP targets FAM164C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, C6 cells Positive IHC detected in: human kidney tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information FAM164C, also named as ZC2HC1C or C14orf140, is a 456 amino acid protein, which contains one C2HC-type zinc finger and belongs to the ZC2HC1 family. FAM164C exists as two isoforms. The isoform1 is a 51kDa protein ad isoform2 is 31kDa. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14359 Product name: Recombinant human FAM164C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC004259 Sequence: MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG Predict reactive species Full Name: family with sequence similarity 164, member C Calculated Molecular Weight: 275 aa, 31 kDa Observed Molecular Weight: 31-36 kDa GenBank Accession Number: BC004259 Gene Symbol: FAM164C Gene ID (NCBI): 79696 RRID: AB_2878697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53FD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924