Proteintech, 20528-1-AP, EIF1AD Polyclonal antibody

Size: 20ul / 150ul The EIF1AD (20528-1-AP) by Proteintech is a Polyclonal antibody targeting EIF1AD in WB, ELISA applications with reactivity to human, mouse, rat samples 20528-1-AP targets EIF1AD in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells, HEK-293 cells, HL-60 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14390 Product name: Recombinant human EIF1AD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC005131 Sequence: MSQATKRKHVVKEVLGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA Predict reactive species Full Name: eukaryotic translation initiation factor 1A domain containing Calculated Molecular Weight: 165 aa, 19 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC005131 Gene Symbol: EIF1AD Gene ID (NCBI): 84285 RRID: AB_10693533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N9N8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.