Proteintech, 20532-1-AP, HIST1H3D Polyclonal antibody

Size: 20ul / 150ul The HIST1H3D (20532-1-AP) by Proteintech is a Polyclonal antibody targeting HIST1H3D in WB, ELISA applications with reactivity to human, mouse samples 20532-1-AP targets HIST1H3D in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14394 Product name: Recombinant human HIST1H3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC031333 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species Full Name: histone cluster 1, H3d Calculated Molecular Weight: 136 aa, 15 kDa Observed Molecular Weight: 15-25 kDa GenBank Accession Number: BC031333 Gene Symbol: HIST1H3D Gene ID (NCBI): 8351 RRID: AB_2811276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.