Iright
BRAND / VENDOR: Proteintech

Proteintech, 20595-1-AP, POLR1A Polyclonal antibody

CATALOG NUMBER: 20595-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POLR1A (20595-1-AP) by Proteintech is a Polyclonal antibody targeting POLR1A in WB, IP, ELISA applications with reactivity to human samples 20595-1-AP targets POLR1A in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information POLR1A, DNA-directed RNA polymerase I subunit RPA1, is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA. RNA polymerase I (Pol I) located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I ranscription. Together with the second largest subunit, it is the catalytic core component of RNA polymerase I that synthesizes ribosomal RNA precursors. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14543 Product name: Recombinant human RPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 295-574 aa of BC017115 Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR Predict reactive species Full Name: polymerase (RNA) I polypeptide A, 194kDa Calculated Molecular Weight: 1720 aa, 195 kDa Observed Molecular Weight: 190-195 kDa GenBank Accession Number: BC017115 Gene Symbol: POLR1A Gene ID (NCBI): 25885 RRID: AB_10949227 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924