Proteintech, 20615-1-AP, SLC25A40 Polyclonal antibody

Size: 20ul / 150ul The SLC25A40 (20615-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A40 in WB, IHC, ELISA applications with reactivity to human, mouse samples 20615-1-AP targets SLC25A40 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, mouse kidney tissue, mouse liver tissue Positive IHC detected in: human placenta tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:100-1:1000 Background Information SLC25A40 (solute carrier family 25, member 40) is one of the solute carrier (SLC) transporters that comprise a family of MCS transporters and uptakes GSH into mitochondria (PMID: 37407483). The SLC25A40 mRNA levels were significantly increased in both the kidneys of LPS mice and KMRC-1 cells after LPS treatment, when compared with those in the controls (PMID: 35955707). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14669 Product name: Recombinant human SLC25A40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC027322 Sequence: MDPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQNNPLPKGKCFVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIKSLWSGLPPT Predict reactive species Full Name: solute carrier family 25, member 40 Calculated Molecular Weight: 338 aa, 38 kDa Observed Molecular Weight: 30~38 kDa GenBank Accession Number: BC027322 Gene Symbol: SLC25A40 Gene ID (NCBI): 55972 RRID: AB_3669338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TBP6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.