Proteintech, 20623-1-AP, ABHD12B Polyclonal antibody

Size: 20ul / 150ul The ABHD12B (20623-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD12B in WB, IHC, ELISA applications with reactivity to human, mouse samples 20623-1-AP targets ABHD12B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue, mouse kidney tissue Positive IHC detected in: human skin tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14426 Product name: Recombinant human ABHD12B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC034603 Sequence: MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS Predict reactive species Full Name: abhydrolase domain containing 12B Calculated Molecular Weight: 362 aa, 41 kDa Observed Molecular Weight: 41 kDa, 29 kDa GenBank Accession Number: BC034603 Gene Symbol: ABHD12B Gene ID (NCBI): 145447 RRID: AB_10693623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z5M8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.