Proteintech, 20626-1-AP, SLC22A15 Polyclonal antibody

Size: 20ul / 150ul The SLC22A15 (20626-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A15 in WB, ELISA applications with reactivity to human samples 20626-1-AP targets SLC22A15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, human brain tissue, human heart tissue, human placenta tissue, human skeletal muscle tissue, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14547 Product name: Recombinant human SLC22A15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-535 aa of BC026358 Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK Predict reactive species Full Name: solute carrier family 22, member 15 Calculated Molecular Weight: 535aa,59 kDa; 547aa,61 kDa Observed Molecular Weight: 61-66 kDa GenBank Accession Number: BC026358 Gene Symbol: SLC22A15 Gene ID (NCBI): 55356 RRID: AB_10693537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.