Proteintech, 20634-1-AP, CXCR2 Polyclonal antibody

Size: 20ul / 150ul The CXCR2 (20634-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples 20634-1-AP targets CXCR2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, COLO 320 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14670 Product name: Recombinant human IL-8RB/CXCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species Full Name: interleukin 8 receptor, beta Calculated Molecular Weight: 360 aa, 41 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC037961 Gene Symbol: IL8RB Gene ID (NCBI): 3579 RRID: AB_10693624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.