Proteintech, 20640-1-AP, HERPUD2 Polyclonal antibody

Size: 20ul / 150ul The HERPUD2 (20640-1-AP) by Proteintech is a Polyclonal antibody targeting HERPUD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20640-1-AP targets HERPUD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information HERPUD2, also named as Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, is a 406 amino acid protein, which contains one ubiquitin-like domain. HERPUD2 as a single-pass membrane protein could be involved in the unfolded protein response (UPR) pathway. HERPUD2 may exstis as two isoforms 406aa,45 kDa and 297aa 33 kDa (Genebank:EAW94050). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14702 Product name: Recombinant human HERPUD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC005091 Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH Predict reactive species Full Name: HERPUD family member 2 Calculated Molecular Weight: 406 aa, 45 kDa Observed Molecular Weight: 35-45 kDa GenBank Accession Number: BC005091 Gene Symbol: HERPUD2 Gene ID (NCBI): 64224 RRID: AB_2878714 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.