Iright
BRAND / VENDOR: Proteintech

Proteintech, 20765-1-AP, NT5M Polyclonal antibody

CATALOG NUMBER: 20765-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NT5M (20765-1-AP) by Proteintech is a Polyclonal antibody targeting NT5M in WB, IP, ELISA applications with reactivity to mouse samples 20765-1-AP targets NT5M in WB, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information NT5M is a mitochondrial 5′(3′)-deoxyribonucleotidase that plays a crucial role in maintaining balanced deoxynucleotide pools essential for mitochondrial DNA synthesis. It dephosphorylates specific nucleoside monophosphates, particularly dUMP and dTMP, thereby preventing the accumulation of toxic dTTP. NT5M is predominantly localized in mitochondria and is highly expressed in tissues such as the heart, brain, and skeletal muscle. Specification Tested Reactivity: mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14743 Product name: Recombinant human NT5M protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-228 aa of BC035838 Sequence: LRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC Predict reactive species Full Name: 5',3'-nucleotidase, mitochondrial Calculated Molecular Weight: 228 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC035838 Gene Symbol: NT5M Gene ID (NCBI): 56953 RRID: AB_10733338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924