Iright
BRAND / VENDOR: Proteintech

Proteintech, 20767-1-AP, TRMT2B Polyclonal antibody

CATALOG NUMBER: 20767-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRMT2B (20767-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT2B in WB, IHC, ELISA applications with reactivity to human samples 20767-1-AP targets TRMT2B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14750 Product name: Recombinant human TRMT2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-247 aa of BC007526 Sequence: TPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHP Predict reactive species Full Name: TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae) Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC007526 Gene Symbol: TRMT2B Gene ID (NCBI): 79979 RRID: AB_10693626 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924