Iright
BRAND / VENDOR: Proteintech

Proteintech, 20780-1-AP, C11orf70 Polyclonal antibody

CATALOG NUMBER: 20780-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C11orf70 (20780-1-AP) by Proteintech is a Polyclonal antibody targeting C11orf70 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20780-1-AP targets C11orf70 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, MCF-7 cells Positive IHC detected in: human testis tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The CFAP300 protein is an important member of the cilia- and flagella-associated protein family, localized in the basal body and axoneme structures of cellular cilia. It plays a central role in ciliary assembly and stability, primarily by participating in the transport and anchoring of pre-assembled complexes within the cytoplasm. Research indicates that mutations in the CFAP300 gene lead to structural and functional defects in cilia, which are closely associated with various human ciliopathies, such as primary ciliary dyskinesia, heterotaxy, and male infertility. Loss of its function disrupts intraflagellar transport, affecting key physiological processes including left-right axis determination during embryonic development and mucociliary clearance in the respiratory tract. Therefore, CFAP300 is a crucial protein molecule for understanding ciliary biology and the mechanisms of related diseases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14793 Product name: Recombinant human C11orf70 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC006128 Sequence: MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS Predict reactive species Full Name: chromosome 11 open reading frame 70 Calculated Molecular Weight: 267 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC006128 Gene Symbol: C11orf70 Gene ID (NCBI): 85016 RRID: AB_10755147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924