Iright
BRAND / VENDOR: Proteintech

Proteintech, 20781-1-AP, PDCD2L Polyclonal antibody

CATALOG NUMBER: 20781-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDCD2L (20781-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD2L in WB, ELISA applications with reactivity to human, mouse samples 20781-1-AP targets PDCD2L in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, A549 cells, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14795 Product name: Recombinant human PDCD2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC006146 Sequence: MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK Predict reactive species Full Name: programmed cell death 2-like Calculated Molecular Weight: 358 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC006146 Gene Symbol: PDCD2L Gene ID (NCBI): 84306 RRID: AB_2878736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924